<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28370
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MPVEVFLITVVPAADTTKARSVLHGYTETRPVTHRFTRVRHVRRLDQSIRGIPILRSLQSSNPKPDSLAQWQDLHSTLSRQQYMLTERVDITQDAEAAVAAGQPVPMSEQTQKGERILRFNDFPDPPNPRVPQTVMQRKQIDIREPGPLLEQHMADSGFSVANEYIEETYHWWDNNNLEFVLWRQYNDLPNPTPAPLVQAPDQANWMVPDMSKMEPVAPFWMLYVRALVDANPVDRMAERMAEAHGRLGKVEKELEGVFSFMVFDRRALDTRYTGEDPDLLAVKNSTRREVPRRLWPQVSVVCVSLGVQS |
| Length | 310 |
| Position | Head |
| Organism | Neurospora tetrasperma (strain FGSC 2509 / P0656) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Sordariaceae> Neurospora.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.510 |
| Instability index | 55.46 |
| Isoelectric point | 6.02 |
| Molecular weight | 35592.09 |
| Publications | PubMed=21750257
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28370
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.12| 16| 39| 213| 228| 1
---------------------------------------------------------------------------
213- 228 (31.03/18.68) KMEPVAPFWMLYVRAL
254- 269 (28.09/16.34) ELEGVFSFMVFDRRAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.65| 17| 64| 115| 131| 2
---------------------------------------------------------------------------
115- 131 (34.13/15.75) ERIL..RFNDFPDP.PNPRV
164- 177 (21.36/ 7.68) EYIE..ETYHWWDN.NN...
179- 198 (22.16/ 8.18) EFVLwrQYNDLPNPtPAPLV
---------------------------------------------------------------------------
|