<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28357
Description |
Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MDGNGTDAVYLEVIIRTMDSPLNLRPRPPNSRGPQTIADFIRRVNAEPGGFRALNEEEVRRNVIAERNGLHHEDVEMVTDQEADDDSKKPDIIAARHNIIMSLGQAIQISSNFLDFISLLLSKEIPTQAAVSISPWLRNQVPIGSIGATQLDAPTPLTQSRVADNKLITIGKRLVALNEAADTALAAANRLRQEINSETKYWQEVLTVSQKGWSTARLPQEPHDMGVKFGFSNAAPMFKNNSVAPLKRAEDGSVRLEYGRMGSKSERLQATLLHNREVVGRSSLPRPLPDDAPLDDRVKEARNTIFAQELWHEINREGRTLHGHHVRLEQSAVTCALDPNRTISFELVGLDDQDHSRVPLPGDLDAETASITLHLLLSNAHRQNQLKRSERTAANAMRGPPPPYNLLLPIITYYRHEKTLEDCTTFLAAFCGALRSAGIQSSFSMTESINKGSPTAPPSEALMKTLLHPSEVQFDLTITPASRVRILAKPTPVFGTRFSIYLLHPQSNHLTSSFPPNQTDSVYENIKELVRYLSNAVPRALTMYYYPLVQEMRNSGNKGNNGETPIPPAPNTTTWIIHPDDLGLVDDDTETFGVRFAFTSNYTCGDEVGDAAKEPELRVTGDYMEDGKRVQHEWKWTASGPAATQGGGSLDEIVKHILANGPSSSVLSA |
Length | 669 |
Position | Head |
Organism | Neurospora tetrasperma (strain FGSC 2509 / P0656) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Sordariaceae> Neurospora.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.444 |
Instability index | 45.49 |
Isoelectric point | 5.86 |
Molecular weight | 73907.33 |
Publications | PubMed=21750257
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP28357
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 98.18| 32| 35| 125| 159| 3
---------------------------------------------------------------------------
125- 159 (49.70/44.65) IPTQAAVSISPWLrnqVPIGSIGATQLDAPTPLTQ
162- 193 (48.49/34.19) VADNKLITIGKRL...VALNEAADTALAAANRLRQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.03| 16| 34| 501| 516| 5
---------------------------------------------------------------------------
501- 516 (30.83/20.97) YLLHPQSNHLTSSFPP
532- 547 (30.20/20.38) YLSNAVPRALTMYYYP
---------------------------------------------------------------------------
|