<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28353
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MSRIETENELKQFTGMEYALVHAQPPLFVIQQRHRLSPTEVRPTAVYFILNNVLYSGPDLYTLLSTKLTNALNMIQGSLDILRAARPDYTPRIGHVWPIIDEPTNKTGTSKAQQPARQGSLVPGTPMDISGGSQPIKGHDPSQMGTKRDGAGAHGNEGAGTTEEENEMNQIWDPFAVALQSLRFDMEKKRHAAIQAAEQQQQLVGASGSGSSFAAAAGAGGIGPLSTTGAPTTGLGDDARAGIGAGTRSTTLGPDARSSLVTGPLGSTTSGGGGQIPGGSGAARFTVPTADGPSSSARLKGVPGPPGKPGQGKKNNVVSSLVLIGMNTRICVIDCQTAS |
Length | 339 |
Position | Head |
Organism | Serendipita indica (strain DSM 11827) (Root endophyte fungus) (Piriformospora indica) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Sebacinales> Serendipitaceae> Serendipita.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.347 |
Instability index | 37.18 |
Isoelectric point | 8.52 |
Molecular weight | 35046.93 |
Publications | PubMed=22022265
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP28353
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 67.26| 14| 15| 233| 246| 1
---------------------------------------------------------------------------
233- 246 (25.50/10.47) TGLGDDARAGIGAG
250- 263 (20.10/ 6.72) TTLGPDARSSLVTG
270- 283 (21.66/ 7.81) SGGGGQIPGGSGAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.23| 17| 22| 92| 110| 2
---------------------------------------------------------------------------
92- 110 (28.64/20.05) RIGHVWPiiDEPTNKTGTS
117- 133 (31.59/16.40) RQGSLVP..GTPMDISGGS
---------------------------------------------------------------------------
|