<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28346

Description Related to SSN3-cyclin-dependent CTD kinase
SequenceMASSPVTQVDQMAAWRARKDARRATVQSKYTILGFISSGTYGRVYKARERDPPSKDSPFDVTVEPKLFAIKKFKPEKEGEVLTYTGISQSAIREIALNREIQHENVVALKEAILEDKSIYMVFEYAEHDFLQLIHHHSQVRRSIGLAVLKSLIHQLLNGLVYLHSVHILHRDLKPANILITASGVVKIGDLGLARLIYQPLQPLVQGDKVVVTIWYRAPELLLGAKHYNYAIDCWAVGCVFAEMIGLKPIFKGEEAKIDPKKNLPFQREQLGKIFDVLGPPDEKKWPDLTIMPEYNTLQTMNPSRWKASSLHRWWENHKLKGEAGYNLLATLFEYDPGKRLTAYQALHHAWFNEEPLPNHNVFFSTRETYPQRRISDDAPSMLGAPTASRPNSGTVHAGKPPIVNMPRKRQRIE
Length414
PositionKinase
OrganismSerendipita indica (strain DSM 11827) (Root endophyte fungus) (Piriformospora indica)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Sebacinales> Serendipitaceae> Serendipita.
Aromaticity0.09
Grand average of hydropathy-0.373
Instability index46.78
Isoelectric point9.36
Molecular weight47168.81
Publications
PubMed=22022265

Function

Annotated function 
GO - Cellular Component
euchromatin	GO:0000791	IEA:EnsemblFungi
mediator complex	GO:0016592	IEA:EnsemblFungi

GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IEA:EnsemblFungi

GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:EnsemblFungi









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28346
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.97|      18|      43|     144|     161|       2
---------------------------------------------------------------------------
  144-  161 (30.25/21.58)	IGLAVLKSLIHQLLNGLV
  188-  205 (32.72/23.91)	IGDLGLARLIYQPLQPLV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     136.73|      40|     204|      44|      83|       3
---------------------------------------------------------------------------
   44-   83 (68.93/45.87)	VYKARE.RDPPSKDSPFDVTVEPKLFAIKKFKPEKEGEVLT
  250-  290 (67.79/44.99)	IFKGEEaKIDPKKNLPFQREQLGKIFDVLGPPDEKKWPDLT
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28346 with CDK8 domain of Kingdom Fungi
Unable to open file!