<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28343
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MAAKPAVTSYEVFLTGSFPASDKTMLREVENRLSLHTDTSFVLHRQDYDFALGVTNDFTTLNAANLRGSGQGAPLRVKRDLTAVDGRSSEWTLHTYLKPTPTYTTAAVRSCCSIPLLSGDALSFASAMGYKPTATTTRKGYTFLKGSIVIMLYQLVTSPAESNLNPWNIEVTHTVTIDGVRNARIPAATLIKNSVDNVVAVAVLMKGLVDLRPPKL |
| Length | 216 |
| Position | Head |
| Organism | Serendipita indica (strain DSM 11827) (Root endophyte fungus) (Piriformospora indica) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Sebacinales> Serendipitaceae> Serendipita.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.011 |
| Instability index | 24.75 |
| Isoelectric point | 9.27 |
| Molecular weight | 23437.62 |
| Publications | PubMed=22022265
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28343
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.17| 16| 128| 1| 17| 1
---------------------------------------------------------------------------
1- 17 (25.51/19.00) MAAKPAVT....SYeVFLTGS
128- 147 (26.65/15.15) MGYKPTATttrkGY.TFLKGS
---------------------------------------------------------------------------
|