<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28336
Description |
Uncharacterized protein |
Sequence | MGVRGIARWSNAPSTGVQLISDSVSRQHGARPSGSWQAEIRAIRRHTYVDGVTSVGGERLLWEYTNAGDQVLTIIEDPTAPKRADYMAARAEAMQANAAKQQAGLEVAELPPLPPHFRHTLISYRQASIEALLDQLGGAWNLQQQKPTDLGMMGRPTGGTTHRLRIEGRVWNIGSDWIVRVGGVFAIGEQFKGVIMEIEYLPVDVLPQDDGSSVFLDQFTASLIPSQLPSEANFNSVVIADKEWAHVCGIDIASGSSPADEDIYVYGDEEQTAEDPSHKDDWRRSAYMIVLAFHGEGIA |
Length | 299 |
Position | Head |
Organism | Serendipita indica (strain DSM 11827) (Root endophyte fungus) (Piriformospora indica) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Sebacinales> Serendipitaceae> Serendipita.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.288 |
Instability index | 49.55 |
Isoelectric point | 4.96 |
Molecular weight | 32736.28 |
Publications | PubMed=22022265
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28336
No repeats found
|