<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28333

Description Mediator of RNA polymerase II transcription subunit 6
SequenceMAAKPDTSLPDEIQWNSMEHVMQFGGIHDNTILYYFAASPFFDPTSNNAVVFSQAVRNQSQLHIIATRQAFEARLREMSGLEYIVAQEPAETGPGMGTGVWVIRKQTRRKVKGSNGFPAPDEIEVHSDYFVVGENIYMAPSLANILSSRIASIASSITKTFPIADSIKKWSPALGHGYKTPATNSLTSRPRGTGLESKEATPMPESQTSSAMTAAKNADRSDPDEKLAEESFAIHTHYGTEYMDENPITGKPGDFHFSSTGRKERLNVPGQQQGKAIGSGPDTTLPVLKTLPDNSPLSKDAKSEKTGKTGGPPKPKRRKSKGGPNTPS
Length328
PositionHead
OrganismMagnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Magnaporthales> Pyriculariaceae> Pyricularia.
Aromaticity0.07
Grand average of hydropathy-0.647
Instability index50.36
Isoelectric point8.84
Molecular weight35548.43
Publications
PubMed=15846337

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364143
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP28333
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.42|      14|      18|     175|     188|       1
---------------------------------------------------------------------------
  175-  188 (26.77/15.82)	GHGYK..TPATNSLTS
  194-  209 (21.65/11.47)	GLESKeaTPMPESQTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     102.80|      31|      42|     252|     283|       2
---------------------------------------------------------------------------
  252-  283 (52.46/34.03)	PGDFHFSSTGRKERL....NVPGQQQGKAIGsGPDT
  292-  326 (50.34/28.29)	PDNSPLSKDAKSEKTgktgGPPKPKRRKSKG.GPNT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.27|      10|      18|     111|     120|       3
---------------------------------------------------------------------------
  111-  120 (19.90/11.15)	VKGSNGFPAP
  131-  140 (19.36/10.67)	VVGENIYMAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.32|      33|     210|       2|      40|       4
---------------------------------------------------------------------------
    2-   40 (47.82/62.33)	AAK.PDTSLPDEiqwNSMEHvmQFgGIHDNTILYYFAASP
  214-  247 (56.49/44.69)	AAKnADRSDPDE...KLAEE..SF.AIHTHYGTEYMDENP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.17|      14|      18|      52|      69|       5
---------------------------------------------------------------------------
   52-   65 (24.06/23.77)	FSQAVRNQSQLHII
   71-   84 (24.11/11.67)	FEARLREMSGLEYI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28333 with Med6 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) YKTPATNSLTSRPRGTGLESKEATPMPESQTSSAMTAAKNADRSDPDEKLAEESFAIHTHYGTEYMDENPITGKPGDFHFSSTGRKERLNVPGQQQGKAIGSGPDTTLPVLKTLPDNSPLSKDAKSEKTGKTGGPPKPKRRKSKGGPNTPS
178
328










Molecular Recognition Features






MoRF SequenceStartStop




1) GPPKPKRRKSKGG
2) LSKDAKSE
311
297
323
304