<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28314
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MHELLLFASVPAHQHHELLQQLAGLTAMQPRHRLERRLVFKAYRKPGLTNTRVGASQDLQGVELQRLNKMLNGGMFYTQVVGPVAKADFGGNPSSSGDPDVSMSGLEEKPSSSSSSYSYEDQPWKLEFRDIPEAGTRSAVTARLMASATLPKGDITAPMNAWGYSFVTEYVVEGDVFVLNDIVIFLHRVLLYPTGAQESHGPRRQLPAYQELSPLERTGSYVLQAAITVQDGGNQEMMRTASQHLFGLREQLKSAVRLEMADRLSLDTRAK |
Length | 271 |
Position | Head |
Organism | Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.355 |
Instability index | 42.78 |
Isoelectric point | 6.72 |
Molecular weight | 30044.76 |
Publications | PubMed=21543515
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP28314
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.36| 13| 14| 84| 96| 1
---------------------------------------------------------------------------
84- 96 (23.04/16.10) VAKADFGGNPSSS
101- 113 (22.32/15.38) VSMSGLEEKPSSS
---------------------------------------------------------------------------
|