<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28313
Description |
Mediator of RNA polymerase II transcription subunit 10 (Fragment) |
Sequence | MAPIPLSTVDTDLKDVIQHLFEIQSAVHGYLGPETQQELVRKIKNLTLALSTLSTHTSDNHPDAQSQSPGNSNDPPIHSIQLPPEIIDYVDAARNPDIYTREFVELIQRGNQDLRGKKEAFGSFRDVLAREMRGAMPEVRGEVDRVVASFGGDGNGNNNGEGRG |
Length | 164 |
Position | Middle |
Organism | Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.604 |
Instability index | 23.36 |
Isoelectric point | 5.04 |
Molecular weight | 17986.73 |
Publications | PubMed=21543515
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP28313
No repeats found
|