<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28285
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | LSRLSSLIGCKTEPPPPPPATLGFGPGKPPPPPPPPPGGGPGTVPPAAAAPAPPGADKAAAGCGPFYLMRELPGSTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSGLRSLIEKPPILGGSFNPITGTMLAGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPSMGSSQASSSSSLR |
Length | 245 |
Position | Head |
Organism | Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Metatheria> Dasyuromorphia> Dasyuridae> Sarcophilus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.961 |
Instability index | 72.58 |
Isoelectric point | 9.92 |
Molecular weight | 26301.01 |
Publications | PubMed=21709235
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP28285
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 68.57| 16| 16| 191| 206| 2
---------------------------------------------------------------------------
174- 195 (22.87/ 8.77) KKNKHKHKQSRtqdpvpPETPS
196- 214 (20.74/ 7.34) DSDHKKKKKKK...eedPERKR
215- 232 (24.95/10.17) KKKEKKKKKNR....hsPEHPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 132.15| 40| 46| 69| 114| 4
---------------------------------------------------------------------------
69- 112 (68.69/40.51) MRELPGSTELTGSTNLITHYN.LEHAYNKFCGkkvkEKLSNF......LPD
116- 162 (63.46/26.32) MIDLPGSHDNSGLRSLIEKPPiLGGSFNPITG....TMLAGFrlhagpLPE
---------------------------------------------------------------------------
|