<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28271
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MEAPPVTMMPVTGGTINMMEYLLQGSVLDHSLESLIHRLRGLCDNMEPETFLDHEMVFLLKGQQASPFVLRARRSMDKTGAPWHLRYLGQPEMGDKNRHALVRNCVDIATSENLTDFLMEMGFRMDHEFVAKGHLFRKGIMKIMVYKIFRILMPGNTDSTEALSLSYLVELSVVAPAGQDMVSDDMRNFAEQLKPLVHLEKIDPKRLM |
Length | 208 |
Position | Head |
Organism | Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.141 |
Instability index | 39.03 |
Isoelectric point | 6.06 |
Molecular weight | 23724.54 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28271
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 182.04| 48| 64| 9| 58| 1
---------------------------------------------------------------------------
9- 55 (75.41/38.89) ........................MPVTGGTINM..MEYLLQGSVLDHSLESLI.HRL......RGLCDNMEPETF.LDHE
58- 128 (62.55/33.93) F......llkgqqaspfvlrarrsMDKTGAPWH...LRYLGQPEMGDKNRHALV.RNCvdiatsENLTDFLMEMGFrMDHE
129- 200 (44.08/17.76) FvakghlfrkgimkimvykifrilMPGNTDSTEAlsLSYLVELSVVAPAGQDMVsDDM......RNFAEQLKPLVH.LE..
---------------------------------------------------------------------------
|