<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28269
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAASSAAEKEKERPGSVSIANVPGNSTREKLLSVLEDLEVLSRELIENLAISRSQKLLQPGEENQIIELLIHRDGEFQELMKLALEQGKVHHEMQLLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIDKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSSDMSVNMLPPNHSNDFMLEPPGHNKENEDDVEVMSTDSSSSSSDSD |
| Length | 271 |
| Position | Middle |
| Organism | Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Metatheria> Dasyuromorphia> Dasyuridae> Sarcophilus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.631 |
| Instability index | 51.85 |
| Isoelectric point | 4.96 |
| Molecular weight | 29938.27 |
| Publications | PubMed=21709235
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
|
| GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
transcription by RNA polymerase II GO:0006366 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP28269
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 95.17| 24| 24| 95| 118| 1
---------------------------------------------------------------------------
56- 87 (28.47/15.73) KLLQPGEEnqiielliHRDGEFQELMKLALEQ
95- 118 (36.33/21.80) QLLEKEVE........KRDSDIQQLQKQLKEA
120- 143 (30.37/17.20) QILATAVY........QAKEKLKSIDKARKGA
---------------------------------------------------------------------------
|