<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28267
Description |
Mediator complex subunit 30 |
Sequence | MSTPPLAGAGMPPGAFTGPQAQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLGKLQDHLRQLSILFRKLRLVYDKCNENCAGLDPIPIEQLIPYVEEDGSKNDDRGASGQLRFASEERTEIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
Length | 179 |
Position | Head |
Organism | Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Metatheria> Dasyuromorphia> Dasyuridae> Sarcophilus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.533 |
Instability index | 40.79 |
Isoelectric point | 7.70 |
Molecular weight | 20288.02 |
Publications | PubMed=21709235
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28267
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.54| 20| 36| 34| 55| 1
---------------------------------------------------------------------------
34- 55 (29.90/30.71) RIGQetVQDIVYRTMEIFQLLR
73- 92 (33.63/26.39) RLGK..LQDHLRQLSILFRKLR
---------------------------------------------------------------------------
|