<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28266
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | QTAAVVMDTSDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKEPDYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQQPQQNSSNASSAGK |
Length | 140 |
Position | Middle |
Organism | Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.14 |
Grand average of hydropathy | -0.720 |
Instability index | 36.47 |
Isoelectric point | 8.73 |
Molecular weight | 16716.80 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28266
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 106.11| 35| 44| 23| 66| 1
---------------------------------------------------------------------------
23- 64 (48.15/50.13) LEFVQCLanpNYLNFLaQRGYFKdKAFVN.....YL..KYLLYWKEpdY
68- 109 (57.96/29.45) LKYPQCL...HMLELL.QYEHFR.KELVNaqcakFIdeQQILHWQH..Y
---------------------------------------------------------------------------
|