<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28266
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | QTAAVVMDTSDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKEPDYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQQPQQNSSNASSAGK |
| Length | 140 |
| Position | Middle |
| Organism | Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.14 |
| Grand average of hydropathy | -0.720 |
| Instability index | 36.47 |
| Isoelectric point | 8.73 |
| Molecular weight | 16716.80 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28266
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 106.11| 35| 44| 23| 66| 1
---------------------------------------------------------------------------
23- 64 (48.15/50.13) LEFVQCLanpNYLNFLaQRGYFKdKAFVN.....YL..KYLLYWKEpdY
68- 109 (57.96/29.45) LKYPQCL...HMLELL.QYEHFR.KELVNaqcakFIdeQQILHWQH..Y
---------------------------------------------------------------------------
|