<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28262
| Description |
Mediator complex subunit 22 |
| Sequence | MAQQRVLPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRGLQDECDKKLISLRDEISIDLYELEEEYYSSSYSLCDTIDLPLCEAYWRQDLTSFSPDGLPAPLLVSPAEPGTAPLQGTTPVLPHVNGPGPGPTEHA |
| Length | 203 |
| Position | Head |
| Organism | Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.528 |
| Instability index | 61.76 |
| Isoelectric point | 4.57 |
| Molecular weight | 22808.37 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28262
No repeats found
No repeats found
|