<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28255
Description |
Uncharacterized protein |
Sequence | MAMEDEILRIAKKIDKMVQKKNPAGALVLLKELKNVPMTLELLQSTKIGISVNTVRKQSTDEEVASLAKSLVKCWKKLVCGFSKTQMKPKKEPPTSSQSSPEPGQERSSSIKANQGKEETNASHSLIKSFPRAPSTSDWVRIKCREMLAAALRTGDDYIAIGADVEELAAQIEEAVYQELRNRDIKYKNRVRSRIANLKDAKNPNLRKNVLYGNIRPDCFARMTAEEM |
Length | 228 |
Position | Unknown |
Organism | Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Metatheria> Dasyuromorphia> Dasyuridae> Sarcophilus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.596 |
Instability index | 48.15 |
Isoelectric point | 9.55 |
Molecular weight | 25591.35 |
Publications | PubMed=21709235
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP28255
No repeats found
No repeats found
|