<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28255
| Description |
Uncharacterized protein |
| Sequence | MAMEDEILRIAKKIDKMVQKKNPAGALVLLKELKNVPMTLELLQSTKIGISVNTVRKQSTDEEVASLAKSLVKCWKKLVCGFSKTQMKPKKEPPTSSQSSPEPGQERSSSIKANQGKEETNASHSLIKSFPRAPSTSDWVRIKCREMLAAALRTGDDYIAIGADVEELAAQIEEAVYQELRNRDIKYKNRVRSRIANLKDAKNPNLRKNVLYGNIRPDCFARMTAEEM |
| Length | 228 |
| Position | Unknown |
| Organism | Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Metatheria> Dasyuromorphia> Dasyuridae> Sarcophilus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.596 |
| Instability index | 48.15 |
| Isoelectric point | 9.55 |
| Molecular weight | 25591.35 |
| Publications | PubMed=21709235
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28255
No repeats found
No repeats found
|