<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28252

Description Transducin (Beta)-like 1 X-linked (Predicted)
SequenceMSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQANAAAAAAAAAATATSTAATTPAAAAQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPPSKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNKKGNYILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDVERGVCIHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGSLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK
Length527
PositionTail
OrganismRattus norvegicus (Rat)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae> Murinae> Rattus.
Aromaticity0.07
Grand average of hydropathy-0.276
Instability index38.46
Isoelectric point5.40
Molecular weight56801.64
Publications
PubMed=15057822
PubMed=15632090

Function

Annotated function 
GO - Cellular Component
histone deacetylase complex	GO:0000118	ISO:RGD
mitotic spindle	GO:0072686	ISO:RGD
nucleus	GO:0005634	ISO:RGD
transcription regulator complex	GO:0005667	ISO:RGD
transcription repressor complex	GO:0017053	ISO:RGD

GO - Biological Function
beta-catenin binding	GO:0008013	ISO:RGD
chromatin binding	GO:0003682	ISO:RGD
DNA binding	GO:0003677	ISO:RGD
histone binding	GO:0042393	ISO:RGD
protein C-terminus binding	GO:0008022	ISO:RGD
protein domain specific binding	GO:0019904	ISO:RGD
transcription corepressor activity	GO:0003714	ISO:RGD
transcription factor binding	GO:0008134	ISO:RGD
transcription regulatory region sequence-specific DNA binding	GO:0000976	ISO:RGD

GO - Biological Process
fat cell differentiation	GO:0045444	ISO:RGD
histone deacetylation	GO:0016575	IBA:GO_Central
negative regulation of transcription by RNA polymerase II	GO:0000122	ISO:RGD
negative regulation of transcription, DNA-templated	GO:0045892	ISO:RGD
positive regulation of canonical Wnt signaling pathway	GO:0090263	ISO:RGD
positive regulation of transcription by RNA polymerase II	GO:0045944	ISO:RGD
positive regulation of transcription, DNA-templated	GO:0045893	ISO:RGD
proteasome-mediated ubiquitin-dependent protein catabolic process	GO:0043161	ISO:RGD
protein stabilization	GO:0050821	ISO:RGD
proteolysis	GO:0006508	ISO:RGD
regulation of transcription by RNA polymerase II	GO:0006357	ISO:RGD
response to estrogen	GO:0043627	ISO:RGD
response to steroid hormone	GO:0048545	ISO:RGD
sensory perception of sound	GO:0007605	ISO:RGD









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28252
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             8|     359.54|      40|      40|     335|     374|       1
---------------------------------------------------------------------------
  171-  211 (45.94/24.01)	PPSKatVLRGHESE...........VFICAWNPVS.........dlL.ASGS.GDSTAR...IWNL...
  235-  269 (43.02/22.02)	VP....S....NKD...........VTSLDWNSDG.........tlL.ATGS.YDGFAR...I.WTEDG
  270-  300 (37.96/18.59)	NLAS..TLGQHKGP...........IFALKWNKKG..........nY...............ILSAGVD
  301-  352 (48.96/26.06)	KTTI..IWDAHTGEakqqfpfhsapALDVDWQNNT..........tF.ASCS.TDMCIH...VCRLGCD
  353-  394 (62.60/35.32)	RPVK..TFQGHTNE...........VNAIKWDPSG.........mlL.ASCS.DDMTLK...IWSMKQD
  395-  447 (42.63/21.76)	ACVH..DLQAHSKE...........IYTIKWSPTGpatsnpnsnimL.ASAS.FDSTVRlwdVERGVC.
  448-  487 (47.81/25.28)	..IH..TLTKHQEP...........VYSVAFSPDG..........kYlASGS.FDKCVH...IWNTQSG
  488-  522 (30.62/13.60)	SLVH..SYRG.TGG...........IFEVCWNARG........dkvG.ASASdGSVCV...........
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28252 with Med16 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) TSTAATTPAAAAQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPPSKA
122
175










Molecular Recognition Features






MoRF SequenceStartStop




NANANA