<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28242
Description |
Uncharacterized protein |
Sequence | LDRQAAAFTSVQHVEAELSAQRYPSPQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLEN |
Length | 72 |
Position | Head |
Organism | Loxodonta africana (African elephant) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Afrotheria> Proboscidea> Elephantidae> Loxodonta.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.708 |
Instability index | 37.62 |
Isoelectric point | 6.92 |
Molecular weight | 8055.90 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28242
No repeats found
No repeats found
|