<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28237
| Description |
Uncharacterized protein |
| Sequence | KRGKREEANSIARRLDKMVTKKSVEGAMDLLRELKAMPVTLHLLQSTRIGMSVNALRKQSSDEEVIALAKSLIKSWKKLLAADASDAKAGERRSTSLASLPSKDTSEGKAHSRKRPELPRTPSTPRMTTFPPVPITCDAVRNKCREMLAAALQTDHDHVAIGADCEHLSAQIEEYILPAG |
| Length | 180 |
| Position | Unknown |
| Organism | Loxodonta africana (African elephant) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Afrotheria> Proboscidea> Elephantidae> Loxodonta.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.501 |
| Instability index | 63.28 |
| Isoelectric point | 9.57 |
| Molecular weight | 19749.58 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28237
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.84| 18| 18| 85| 102| 1
---------------------------------------------------------------------------
85- 102 (29.78/15.19) SDAKAGERRSTSLASLPS
106- 123 (33.07/17.50) SEGKAHSRKRPELPRTPS
---------------------------------------------------------------------------
|