<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28227
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | QQQQQQQQHLILHHQNQQQIQQQQQQQLQRMAQLQLQQQQQQQALQAPPMQQSPMQQPQPPSAQALPQQLQQMHHPQHHQPPPPPPQQPPVAQNQPLQLPPQSVPSQAPALSGQMLYTQQQLKLVRAPMVVQQPQVQPQVQPQVQQQTTVQTPQATQMVASGVQMITAAMAQGGMQVRARFPPSTAVSAAPPGALPTGGQPPAQVFTISTLHPCXXXXXXXXXXPPQSMPPLPSVSQPSAQLTADSTSVGQSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFMPPMAAIHGPPITVPAVCTRKRKFEEDERQSIPNVLQGEVARLDSKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWVDQQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSVHQACLSDA |
| Length | 570 |
| Position | Tail |
| Organism | Loxodonta africana (African elephant) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Afrotheria> Proboscidea> Elephantidae> Loxodonta.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.613 |
| Instability index | 88.41 |
| Isoelectric point | 8.99 |
| Molecular weight | 61645.72 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28227
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.76| 17| 17| 17| 33| 1
---------------------------------------------------------------------------
17- 33 (33.63/ 8.32) QQQIQQQQQQQLQRMAQ
86- 102 (31.13/ 7.10) PQQPPVAQNQPLQLPPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 169.55| 33| 34| 225| 257| 2
---------------------------------------------------------------------------
48- 72 (39.71/ 8.07) ...PPMQQS.PMQQPQP.PSAQ......ALPQQLQQ
125- 151 (38.03/ 7.35) VR.APMV.......VQQ.PQVQPQVQPQVQQQTTVQ
225- 255 (50.50/12.69) ...PPQSMP.PLPSVSQ.PSAQLTADSTSVGQSSGP
256- 290 (41.31/ 8.75) APsPSSFLPsPSPQPSQsPVTARTPQNFSV.PSPGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.40| 23| 28| 345| 371| 5
---------------------------------------------------------------------------
336- 363 (35.23/18.67) DKNEdrkkdLSKMKSLLDILTDPSKRCP
368- 392 (39.17/13.94) QKCE...iaLEKLKNDMAVPTPPPPPVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.02| 22| 232| 181| 205| 6
---------------------------------------------------------------------------
153- 181 (29.03/10.41) PQATQMVASGVqmitAAMAQGG...MQVrarF
182- 206 (36.00/22.14) PPSTAVSAAPP....GALPTGGqppAQV...F
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.69| 17| 191| 103| 124| 9
---------------------------------------------------------------------------
103- 121 (27.11/20.75) SVPSQAPALSGqmLYTQQQ
506- 522 (34.58/12.84) SVPADYPAQSP..LWVDQQ
---------------------------------------------------------------------------
|