<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28213
| Description |
Cyclin dependent kinase 19 |
| Sequence | MDYDFKAKLRGAGAGEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQRLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDEPEEKGEKNQQQQQNQHQQPTAPPQQAAAPPPAPPQQQNSTQTNGTAGGAGAGAGGAGPGLQHSQDAGLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQSTLGYSSSAQQSAQYHSSHQTHRY |
| Length | 501 |
| Position | Kinase |
| Organism | Loxodonta africana (African elephant) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Afrotheria> Proboscidea> Elephantidae> Loxodonta.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.691 |
| Instability index | 52.90 |
| Isoelectric point | 8.78 |
| Molecular weight | 56425.15 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28213
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.97| 18| 22| 373| 394| 1
---------------------------------------------------------------------------
373- 390 (35.39/29.95) QQQNQHQ.QPTAPPQQAAA
397- 415 (28.58/11.33) QQQNSTQtNGTAGGAGAGA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.93| 15| 21| 459| 477| 2
---------------------------------------------------------------------------
463- 477 (26.31/19.56) RLNYQSSVQGSSQSQ
479- 493 (27.62/10.80) TLGYSSSAQQSAQYH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.21| 16| 21| 318| 337| 3
---------------------------------------------------------------------------
318- 333 (27.90/10.75) DPTKRITSEQALQDPY
337- 352 (29.30/16.10) DPLPTLDVFAGCQIPY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.82| 23| 25| 15| 39| 4
---------------------------------------------------------------------------
15- 39 (34.32/31.31) GEDLFEYEGCKVgRGTyGHVYKARR
42- 64 (40.49/25.41) GKDEKEYALKQI.EGT.GISMSACR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 119.22| 36| 40| 186| 225| 6
---------------------------------------------------------------------------
150- 176 (31.61/16.09) .........DLKPANILVMGEGPE.....RGRVKIADMgFA
179- 218 (59.27/44.56) FNSPLKPLADLDPVVVTFWYRAPELllgaRHYTKAIDI.WA
219- 240 (28.35/12.63) IGCIFAELLTSEPI...FHCRQEDI................
---------------------------------------------------------------------------
|