<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28205

Description Mediator complex subunit 14
SequenceMVLTDLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISSFLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKIEKQTTLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDVPWRLLKLEILVEDKETGDGRALVHSMQINFIHQLVQSRLFADEKPLQDMYSCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLSVWNQQVLGRKTGTASVHKVTIKIDENDVSKPLQIFHDPLLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQKLQELKAVLRGFNANENSSIETALPALLVPILEPCSSSECLHIFVDLHSGMFQLMLYGLDQATLDDMEKSMNDDMKQIIPWIQQLKFWLGQQRCKQSIKHLPTISSETLQLSNYSTHPIGSLSKNKLFIKLTRLPQYYIVVEMLEVPNKPTQLAYKYYFLSVTGTDRDDSPVTALVLQQFKENIQDVAVRTKAGMQPRAGAKRKLSGDLCPVEPKKTKRSGETCAFNKVLAHFVAMCDTNMPFVGLRLELSNLEIPHQGVQMEGDGFSHAIRLLKIPPCKGISEETQKVLDRSLLDCTFRLQGRNNRTWVAELVFANCPLNGTSTREQGPSRHVYLTYENLLSEPVGGRKVVEMFLNDWNSIARLYECVLEFARSLPDIPAHLNIFSEVRVYNYRKLILCYGTTKGSSISIQWNSIHQKFHISLGTVGPNSGCSNCHNTILHQLQEMFNKTPNVIQLLQVLFDTQAPLNAINKLPTVPMLGLTQRTNTAYQCFSILPQSSTHIRLAFRNMYCIDIYCRSRGVVAIRDGAYSLFDNSKLVEGFYPAPGLKTFLNMFVDSNQDARRRSVNEDDNPPSPIGGDMMDSLISQLQPQPPPQQQPFPKQPGSSGAYPLTSPPTSYHSTVNQSPSMMHTQSPGNLHAASSPSGALRAPSPASFVPTPPPSSHGISIGPGASFASPHGTLDPSSPYTMVSPSGRAGNWPGSPQVSGPSPATRMPGMSPANPSLHSPVPDASHSPRAGTSSQTMPTNMPPPRKLPQRSWAASIPTILTHSALNILLLPSPTPGLVPGLAGSYLCSPLERFLGSVIMRRHLQRIIQQETLQLINSNEPGVIMFKTDALKCRVALSPKTNQTLQLKVTPENAGQWKPDELQVLEKFFETRVAGPPFKANTLIAFTKLLGAPTHILRDCVHIMKLELFPDQATQLKWNVQFCLTIPPSAPPIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNPPRQGECTIFAAVRDLMANLTLPPGGRP
Length1390
PositionTail
OrganismLoxodonta africana (African elephant)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Afrotheria> Proboscidea> Elephantidae> Loxodonta.
Aromaticity0.07
Grand average of hydropathy-0.188
Instability index51.71
Isoelectric point8.98
Molecular weight154294.64
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU365082

GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coactivator activity	GO:0003713	IEA:Ensembl

GO - Biological Process
positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	IEA:Ensembl
stem cell population maintenance	GO:0019827	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28205
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     120.69|      25|      34|     937|     961|       1
---------------------------------------------------------------------------
  937-  957 (35.70/12.51)	.............QPPP...QQQPFPKQPGSSGAYPL
  958-  993 (25.33/ 6.66)	TSP.PtsyhstvnQSPSmmhTQSPGNLHAASSPSGAL
  994- 1024 (30.13/ 9.37)	RAPsP...asfvpTPPP...SSHGISIGPGASFASPH
 1026- 1046 (29.53/ 9.03)	TLD.P........S.SP...YTMVSPS..GRAGNWP.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.06|      24|      24|    1299|    1322|       2
---------------------------------------------------------------------------
 1298- 1321 (39.65/17.07)	KMLFFL..QLTQKTSVPPQEPVSIIV
 1322- 1347 (34.41/13.92)	PIIYDMasGTTQQADIPRQQNSSVAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      94.35|      30|      32|     180|     209|       3
---------------------------------------------------------------------------
  180-  209 (48.92/34.91)	RLLKLEILVEDKETGDGRALVH....SMQINFIH
  210-  243 (45.43/31.85)	QLVQSRLFADEKPLQDMYSCLHsfclSLQLEVLH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      88.03|      28|      35|      13|      45|       4
---------------------------------------------------------------------------
   13-   40 (46.80/40.25)	VERKIEIVQFASRTRQLFV....RLLALVKWA
   46-   77 (41.23/22.51)	VEKCAMISSFLDQQAILFVdtadRLASLARDA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     154.10|      51|     507|     263|     313|       5
---------------------------------------------------------------------------
  263-  313 (91.67/70.59)	YHAGKCLSLSV.WN...QQ......VLGRKTGTASVHKVTI.KIDE..N...DVSKPLQIFHDPLLP
  746-  812 (62.43/45.23)	YGTTKGSSISIqWNsihQKfhislgTVGPNSGCSNCHNTILhQLQEmfNktpNVIQLLQVLFDTQAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     110.55|      33|     507|     539|     627|       6
---------------------------------------------------------------------------
  542-  576 (53.33/17.87)	PRAG.AKRKLSGDLCPvePKKTKRSGETCAFNKVLA
 1081- 1114 (57.22/41.46)	PRAGtSSQTMPTNMPP..PRKLPQRSWAASIPTILT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.78|      24|      27|      88|     114|       7
---------------------------------------------------------------------------
   84-  112 (28.74/29.95)	PSfaIPyAIDVLTTgsYPRLPTCIRDKII
  113-  138 (37.04/23.57)	PPdpIT.KIEKQTT..LHQLNQILRHRLV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.60|      14|      35|    1183|    1197|       8
---------------------------------------------------------------------------
 1183- 1197 (21.47/17.25)	LKCRVALSP.KTNqTL
 1221- 1235 (22.14/12.19)	FETRVAGPPfKAN.TL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.98|      18|      35|     445|     462|       9
---------------------------------------------------------------------------
  445-  462 (31.75/25.13)	HLPT..ISSETLQLSNYSTH
  478-  497 (27.23/20.19)	RLPQyyIVVEMLEVPNKPTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.06|      15|      25|     634|     648|      13
---------------------------------------------------------------------------
  634-  648 (26.94/14.61)	VLDRSLLDCT.FRLQG
  659-  674 (24.12/12.36)	VFANCPLNGTsTREQG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28205 with Med14 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) NQDARRRSVNEDDNPPSPIGGDMMDSLISQLQPQPPPQQQPFPKQPGSSGAYPLTSPPTSYHSTVNQSPSMMHTQSPGNLHAASSPSGALRAPSPASFVPTPPPSSHGISIGPGASFASPHGTLDPSSPYTMVSPSGRAGNWPGSPQVSGPSPATRMPGMSPANPSLHSPVPDASHSPRAGTSSQTMPTNMPPPRKLPQRSWA
904
1106










Molecular Recognition Features






MoRF SequenceStartStop




NANANA