<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28196
Description |
Mediator complex subunit 30 |
Sequence | MSTPPLAASGMPSGMAPGPFSGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQPGKLPNGVTYHTGTYQDRLTKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRASLPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINTMLAMRN |
Length | 185 |
Position | Head |
Organism | Loxodonta africana (African elephant) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Afrotheria> Proboscidea> Elephantidae> Loxodonta.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.619 |
Instability index | 46.98 |
Isoelectric point | 8.79 |
Molecular weight | 21060.96 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
|
GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
Repeats |
>MDP28196
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.58| 21| 69| 84| 104| 1
---------------------------------------------------------------------------
84- 104 (35.66/26.98) KLQDHLRQLSILFRKLR.LVYD
155- 176 (32.91/24.39) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|