Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MKITNARHRDSAGAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
Length | 261 |
Position | Head |
Organism | Gorilla gorilla gorilla (Western lowland gorilla) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Gorilla. |
Aromaticity | 0.04 |
Grand average of hydropathy | -1.017 |
Instability index | 61.96 |
Isoelectric point | 9.86 |
Molecular weight | 28083.73 |
Publications | PubMed=22398555 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro transcription factor binding GO:0008134 IBA:GO_Central |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP28178 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 364.54| 106| 115| 33| 147| 1 --------------------------------------------------------------------------- 33- 147 (180.10/72.43) PPPTALGFGpgkpPPPPPPPAGGGPGTAPPPTAAT....APPgADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMidlpGSHDNSSLRSL 151- 260 (184.43/61.14) PPILSSSFN....PITGTMLAGFRLHTGPLPEQCRlmhiQPP.KKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGM....GSSQASSSSSL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDH 2) ENFTALFGA | 212 19 | 246 27 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab