<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28158

Description Transducin beta like 1 X-linked
SequenceMTELAGASSSCCHRPAGRGAMQSVLHHFQRLRGREGGSHFNTSSPRGEAKMSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASAAAAAAAAATAAATAATTTSAGVSHQNPSKNREATVNGEENRAHSVNNHAKPMEIDGEVEIPSSKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNTNGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNRKGNYILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQEVCIHDLQAHNKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK
Length577
PositionTail
OrganismGorilla gorilla gorilla (Western lowland gorilla)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Gorilla.
Aromaticity0.07
Grand average of hydropathy-0.338
Instability index40.37
Isoelectric point6.08
Molecular weight62452.90
Publications
PubMed=22398555

Function

Annotated function 
GO - Cellular Component
histone deacetylase complex	GO:0000118	IBA:GO_Central
mitotic spindle	GO:0072686	IEA:Ensembl
transcription repressor complex	GO:0017053	IEA:Ensembl

GO - Biological Function
beta-catenin binding	GO:0008013	IEA:Ensembl
histone binding	GO:0042393	IEA:Ensembl
protein C-terminus binding	GO:0008022	IEA:Ensembl
protein domain specific binding	GO:0019904	IEA:Ensembl
transcription corepressor activity	GO:0003714	IBA:GO_Central
transcription factor binding	GO:0008134	IEA:Ensembl
transcription regulatory region sequence-specific DNA binding	GO:0000976	IEA:Ensembl

GO - Biological Process
histone deacetylation	GO:0016575	IBA:GO_Central
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:Ensembl
positive regulation of canonical Wnt signaling pathway	GO:0090263	IEA:Ensembl
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:Ensembl
proteolysis	GO:0006508	IEA:Ensembl
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central
sensory perception of sound	GO:0007605	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28158
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             8|     374.37|      40|      40|     385|     424|       1
---------------------------------------------------------------------------
  228-  257 (34.19/13.23)	..............LRGHESE...........VFICAWNPVS.........dlL.ASGS.GDSTAR
  276-  313 (44.02/18.86)	HCirEGGHDVP..S....NKD...........VTSLDWNTNG.........tlL.ATGS.YDGFAR
  314-  343 (32.31/12.16)	I...WTEDGNLASTLGQHKGP...........IFALKWNRKG..........nY............
  344-  395 (45.89/19.93)	IL..SAGVDKTTIIWDAHTGEakqqfpfhsapALDVDWQNNT..........tF.ASCS.TDMCIH
  396-  437 (61.67/28.95)	VC..RLGCDRPVKTFQGHTNE...........VNAIKWDPSG.........mlL.ASCS.DDMTLK
  438-  488 (57.81/26.75)	IW..SMKQEVCIHDLQAHNKE...........IYTIKWSPTGpatsnpnsnimL.ASAS.FDSTVR
  492-  530 (51.65/23.23)	IE..RGVC...THTLTKHQEP...........VYSVAFSPDG..........kYlASGS.FDKCVH
  531-  572 (46.83/20.47)	IW..NTQSGNLVHSYRG.TGG...........IFEVCWNARG........dkvG.ASASdGSVCV.
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28158 with Med16 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) AATTTSAGVSHQNPSKNREATVNGEENRAHSVNNHAKPMEIDGEVEIPSSKA
174
225










Molecular Recognition Features






MoRF SequenceStartStop




NANANA