<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28140
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MGEPQQVSALPPPPMQYIKEYTDENIRKGLVPKPPPPIRDSYMMFGNQFQCDELIIRPLESQGIERLHPMQFDHKRELKKLNMSILVNFLDLLDILIKSPGSIKREEKLEDLKLLFVHMHHLINEYRPHQARETLRVMMEVQKRQRLETAERFHKHLERVVEMIQGCLASLPDDLPQMEGPDVAGEVPRSVSEGAGVGSSGQAPWLNTEPMDVEEAGASCMAAGHQDKIIPISKRDKLLDNNAAMCSIIDEIA |
| Length | 253 |
| Position | Middle |
| Organism | Gasterosteus aculeatus (Three-spined stickleback) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Perciformes> Cottioidei> Gasterosteales> Gasterosteidae>
Gasterosteus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.453 |
| Instability index | 48.56 |
| Isoelectric point | 5.52 |
| Molecular weight | 28744.94 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28140
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.94| 14| 26| 127| 142| 2
---------------------------------------------------------------------------
127- 142 (21.38/25.10) RPHQAREtlRVMMEVQ
152- 165 (25.56/20.85) RFHKHLE..RVVEMIQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.09| 16| 26| 75| 92| 3
---------------------------------------------------------------------------
75- 92 (21.28/21.00) KRELKKLNMSILvnFLDL
104- 119 (26.80/18.49) KREEKLEDLKLL..FVHM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.86| 23| 26| 20| 45| 4
---------------------------------------------------------------------------
20- 45 (39.85/30.48) EY.TDENIRKglvPKPPPPI.RDSYMMF
48- 72 (35.01/19.19) QFqCDELIIR...PLESQGIeRLHPMQF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 71.30| 14| 14| 188| 201| 5
---------------------------------------------------------------------------
172- 185 (24.19/14.30) PDDLPQMEGPDVAG
188- 201 (22.15/12.51) PRSVSEGAGVGSSG
204- 217 (24.96/14.97) PWLNTEPMDVEEAG
---------------------------------------------------------------------------
|