Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MTEMFSTLFGQNEAQGPGSSSLGFGPGKPPPPLPQNQVSMAGQMPPQLGDEGPTLRKPGAMNEPFYLLRELPVGNELTGNSNLITHYNLEHAFNKFCGKKVKEKLSNFLPELPGMIDCPGTQDGSSLRSLIDKPPVCGNSFSPLTGALLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHKHHRLQDPLPQETPSDTDPKKKKKKRDDDPDRKKKKKDKKKKKNRHSPAHPGLAGSQTNSHSLR |
Length | 243 |
Position | Head |
Organism | Gasterosteus aculeatus (Three-spined stickleback) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Eupercaria> Perciformes> Cottioidei> Gasterosteales> Gasterosteidae> Gasterosteus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.041 |
Instability index | 48.77 |
Isoelectric point | 9.83 |
Molecular weight | 26921.56 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP28139 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 90.74| 25| 26| 158| 183| 1 --------------------------------------------------------------------------- 158- 183 (44.76/24.81) PLPEQYRlMHIQPPKKKSKHKHKHHR 187- 211 (45.98/21.89) PLPQETP.SDTDPKKKKKKRDDDPDR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 71.36| 21| 24| 11| 31| 2 --------------------------------------------------------------------------- 11- 31 (41.17/19.04) QNEAQGPGS..SSLG.FGPGKPPP 35- 58 (30.19/12.21) QNQVSMAGQmpPQLGdEGPTLRKP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 56.74| 18| 21| 97| 114| 3 --------------------------------------------------------------------------- 97- 114 (32.08/18.38) C.GKKVKEKLSNFL..PELPG 118- 138 (24.66/12.61) CpGTQDGSSLRSLIdkPPVCG --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) MFSTLFGQNEAQGPGSSSLGFGPGKPPPPLPQNQVSMAGQMPPQLGDEGPTLRKPGAM 2) PLPEQYRLMHIQPPKKKSKHKHKHHRLQDPLPQETPSDTDPKKKKKKRDDDPDRKKKKKDKKKKKNRHSPAHPGLAGSQTNSHSLR | 4 158 | 61 243 |
MoRF Sequence | Start | Stop |
1) DPKKKKKKRDDDPDRKKKKKDKKKKKNRHSPAH 2) FYLLR 3) KHKHKH 4) YRLMHIQ | 197 65 176 163 | 229 69 181 169 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab