<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28139
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTEMFSTLFGQNEAQGPGSSSLGFGPGKPPPPLPQNQVSMAGQMPPQLGDEGPTLRKPGAMNEPFYLLRELPVGNELTGNSNLITHYNLEHAFNKFCGKKVKEKLSNFLPELPGMIDCPGTQDGSSLRSLIDKPPVCGNSFSPLTGALLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHKHHRLQDPLPQETPSDTDPKKKKKKRDDDPDRKKKKKDKKKKKNRHSPAHPGLAGSQTNSHSLR |
| Length | 243 |
| Position | Head |
| Organism | Gasterosteus aculeatus (Three-spined stickleback) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Perciformes> Cottioidei> Gasterosteales> Gasterosteidae>
Gasterosteus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.041 |
| Instability index | 48.77 |
| Isoelectric point | 9.83 |
| Molecular weight | 26921.56 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28139
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 90.74| 25| 26| 158| 183| 1
---------------------------------------------------------------------------
158- 183 (44.76/24.81) PLPEQYRlMHIQPPKKKSKHKHKHHR
187- 211 (45.98/21.89) PLPQETP.SDTDPKKKKKKRDDDPDR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.36| 21| 24| 11| 31| 2
---------------------------------------------------------------------------
11- 31 (41.17/19.04) QNEAQGPGS..SSLG.FGPGKPPP
35- 58 (30.19/12.21) QNQVSMAGQmpPQLGdEGPTLRKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.74| 18| 21| 97| 114| 3
---------------------------------------------------------------------------
97- 114 (32.08/18.38) C.GKKVKEKLSNFL..PELPG
118- 138 (24.66/12.61) CpGTQDGSSLRSLIdkPPVCG
---------------------------------------------------------------------------
|