<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28122
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MQRLTLEHLNQMVGVEYILLHAQEPILYIIRKQQRQSPTQVIPLADYYIIAGVVYQAPDLGTVISSRALSAVHGIQSAFDEAMAYCRYHPSKGYWWHFKDQEEREKNKPKSKKKEEPSSLFQRHRVDTLLLDLRSKFPPTFYQPKPGEKPIPVEVKKEPEPPTEAVKQEEREPATKSAAPAPPSKPPPEKRARLQ |
| Length | 195 |
| Position | Head |
| Organism | Gasterosteus aculeatus (Three-spined stickleback) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Perciformes> Cottioidei> Gasterosteales> Gasterosteidae>
Gasterosteus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.786 |
| Instability index | 60.09 |
| Isoelectric point | 9.28 |
| Molecular weight | 22446.51 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28122
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.00| 12| 18| 159| 171| 1
---------------------------------------------------------------------------
159- 171 (18.25/ 8.98) PEPPTEAvKQEER
180- 191 (24.75/ 9.34) PAPPSKP.PPEKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.82| 18| 41| 98| 115| 2
---------------------------------------------------------------------------
98- 115 (30.65/15.85) FKDQEEREKNKPKSKKKE
141- 158 (33.17/17.68) FYQPKPGEKPIPVEVKKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.02| 11| 18| 28| 38| 3
---------------------------------------------------------------------------
28- 38 (20.77/12.79) YIIRKQQRQSP
48- 58 (20.25/12.32) YIIAGVVYQAP
---------------------------------------------------------------------------
|