<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28122

Description Mediator of RNA polymerase II transcription subunit 6
SequenceMQRLTLEHLNQMVGVEYILLHAQEPILYIIRKQQRQSPTQVIPLADYYIIAGVVYQAPDLGTVISSRALSAVHGIQSAFDEAMAYCRYHPSKGYWWHFKDQEEREKNKPKSKKKEEPSSLFQRHRVDTLLLDLRSKFPPTFYQPKPGEKPIPVEVKKEPEPPTEAVKQEEREPATKSAAPAPPSKPPPEKRARLQ
Length195
PositionHead
OrganismGasterosteus aculeatus (Three-spined stickleback)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Eupercaria> Perciformes> Cottioidei> Gasterosteales> Gasterosteidae> Gasterosteus.
Aromaticity0.08
Grand average of hydropathy-0.786
Instability index60.09
Isoelectric point9.28
Molecular weight22446.51
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	PIRNR:PIRNR023869

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28122
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.00|      12|      18|     159|     171|       1
---------------------------------------------------------------------------
  159-  171 (18.25/ 8.98)	PEPPTEAvKQEER
  180-  191 (24.75/ 9.34)	PAPPSKP.PPEKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.82|      18|      41|      98|     115|       2
---------------------------------------------------------------------------
   98-  115 (30.65/15.85)	FKDQEEREKNKPKSKKKE
  141-  158 (33.17/17.68)	FYQPKPGEKPIPVEVKKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.02|      11|      18|      28|      38|       3
---------------------------------------------------------------------------
   28-   38 (20.77/12.79)	YIIRKQQRQSP
   48-   58 (20.25/12.32)	YIIAGVVYQAP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28122 with Med6 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) FYQPKPGEKPIPVEVKKEPEPPTEAVKQEEREPATKSAAPAPPSKPPPEKRARLQ
141
195










Molecular Recognition Features






MoRF SequenceStartStop




1) IPVEVKKEPEPPTEAVKQEEREPATKSAAPAPPSKPPPEKRARLQ
151
195