<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28116

Description Mediator complex subunit 27
SequenceMADLVNVGVNLDAFSHAISGIQALRSSVTRVFESLKDGMKNRATLEGREKQFIAEFQDNLQAVNRDLNELERLSGLVGRPSESHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASSLLNQQSLKRSANQMGASAKRRPKVQPSTLVLPPQYVDDVISRIGRMFPDMTIELFRPNGTSAVLLVTLGKVLKAIVVMRSLFIDRTIVRGFNENVYNEDGKLDIWTKSQYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQSSCQRCGRFLQDGLPPTWRDFRTLEAFHDTCRM
Length311
PositionTail
OrganismGasterosteus aculeatus (Three-spined stickleback)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Eupercaria> Perciformes> Cottioidei> Gasterosteales> Gasterosteidae> Gasterosteus.
Aromaticity0.08
Grand average of hydropathy-0.285
Instability index42.55
Isoelectric point9.51
Molecular weight35344.21
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process
retinal cone cell development	GO:0046549	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28116
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      79.08|      19|      30|     264|     282|       1
---------------------------------------------------------------------------
  231-  244 (18.16/11.24)	.....WTKSQYQVFQKVTD
  264-  282 (35.79/29.48)	RSFMTWLRSYIKLFQSSCQ
  297-  310 (25.13/18.45)	RDFRT.....LEAFHDTCR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     108.09|      32|      34|     147|     178|       3
---------------------------------------------------------------------------
  147-  178 (57.17/45.00)	RPKVQPSTLVLPPQYVDDVISRIGRMFPDMTI
  182-  213 (50.91/39.27)	RPNGTSAVLLVTLGKVLKAIVVMRSLFIDRTI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.08|      24|      46|      10|      33|       4
---------------------------------------------------------------------------
   10-   33 (38.95/27.90)	NLDAFSHAISGIQALRSSVTRVFE
   59-   82 (39.13/28.06)	NLQAVNRDLNELERLSGLVGRPSE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28116 with Med27 domain of Kingdom Metazoa
Unable to open file!