<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28113
| Description |
Mediator complex subunit 29 |
| Sequence | MASQQQQQPGGPMLQPGLQATSLSQQQDFDPVHRFKILIPQLKESLQQLQNLMKIASLNLAHNTTIDNAIKSSDTSVQRFDKSLEEFYALCDQLEMCLRLAYECLSQSIDSAKHSPNLVPTATKPDTVQTESMSYAQYLGMIKSQISCAKDIHNALLECSKKISGKGPPQGI |
| Length | 172 |
| Position | Tail |
| Organism | Gasterosteus aculeatus (Three-spined stickleback) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Perciformes> Cottioidei> Gasterosteales> Gasterosteidae>
Gasterosteus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.403 |
| Instability index | 66.21 |
| Isoelectric point | 6.40 |
| Molecular weight | 19023.54 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | eye photoreceptor cell development GO:0042462 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP28113
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.84| 20| 21| 3| 23| 1
---------------------------------------------------------------------------
3- 23 (34.47/21.27) SQQQQ.QPGG..PMLQPGLQaTSL
24- 46 (27.37/12.60) SQQQDfDPVHrfKILIPQLK.ESL
---------------------------------------------------------------------------
|