<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28108
| Description |
"Transcription elongation factor A (SII), 3" |
| Sequence | MTREEDLTRIAKKLDKMVSRNNTEGALDLLRELKSFNMTLKLLQETRIGMSVNGIRKNSTDEEVIALAKLLIKDWKRLLVSHRRLHVKLKHDSSPEKKQPDKSGKEKHNEERRARRADDPSDDEKHLEEPGRTESSDSKPPPQKKMPDPVKIKQMFPFVRKDSSDSKPPLLKKPSLGVKKEKHRCNETKATDMKYKNRVRSRISNLKDPKNPGLRRNVLAGSIDLSRIASMSAQEMASDELKQLRNVLTQEAIREHQMAKTGGTSTDLLQCGKCKKRNCTYNQVQTRSADEPMTTFVLCNECGNRWKFS |
| Length | 309 |
| Position | Unknown |
| Organism | Gasterosteus aculeatus (Three-spined stickleback) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Perciformes> Cottioidei> Gasterosteales> Gasterosteidae>
Gasterosteus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.059 |
| Instability index | 56.77 |
| Isoelectric point | 9.82 |
| Molecular weight | 35471.40 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28108
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 112.57| 26| 26| 125| 150| 1
---------------------------------------------------------------------------
107- 121 (24.70/ 8.40) KHNEE.........RRA..RRADDPS
125- 150 (52.06/24.15) KHLEEPGRTESSDSKPPPQKKMPDPV
153- 174 (35.81/14.80) KQMFPFVRKDSSDSKPPLLKK.P...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.06| 12| 26| 266| 277| 3
---------------------------------------------------------------------------
266- 277 (22.67/13.48) TDLLQCGKCKKR
294- 305 (23.39/14.09) TTFVLCNECGNR
---------------------------------------------------------------------------
|