<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28100
| Description |
Mediator of RNA polymerase II transcription subunit 1 |
| Sequence | LVMESKISKLHLKFAEKTWNETFQLVRRCMDKPKDKSKPCRPLVRSLERLQDVFNVSSMKTMRSRLEMIAKQQGMGFHLTEATCYLTADLFYLEVVLLPYGGVAEVKVAPHGKAPVPSESFLQLLRSKEFAEFSVKLAGLFTQYDIPGDSETRLKLFSSMQWLWKDLQQISQLPSVPKDSDPRVDVMNHGRSGCLIAEKEDFPMTIQFYAPPTDGMKTSDRQETAATEPPVQAARVTVGVSDAAHRLQMASLLPQPPQLDPQGHPVFLSSAEAPHETLPACFLLKLQPAVPMTLSFVDKLRHITDIPIPDVDLQWAPLPKLLTGRSNGPGELPDEQDTIFTVPLPDGALHRYVLLAAAWGEAPAQRAAAVDSIPFTHPAHVPALLQLLRHQSAINTLLRSCIGPPGDGAAGSVPDLHLEVLPESETSFSVTFQRPDADSLAVLLVNVCDSSQITCTLFGSGMVDPSVDEYLSAVMKRFMSVPVTLKALHGRLEESSSAP |
| Length | 499 |
| Position | Middle |
| Organism | Gasterosteus aculeatus (Three-spined stickleback) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Perciformes> Cottioidei> Gasterosteales> Gasterosteidae>
Gasterosteus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.113 |
| Instability index | 53.86 |
| Isoelectric point | 5.81 |
| Molecular weight | 54868.61 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28100
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.10| 16| 77| 167| 183| 1
---------------------------------------------------------------------------
167- 183 (25.93/16.37) LQQISQLPSvPKDSDPR
247- 262 (31.17/15.87) LQMASLLPQ.PPQLDPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 139.03| 38| 131| 190| 245| 3
---------------------------------------------------------------------------
195- 232 (66.37/31.92) LIAEKEDFPMTI.QFYAPPTDG.MKTSDRQETAATEPPVQ
333- 365 (45.35/15.43) .....PDEQDTI..FTVPLPDGaLHRYVLLAAAWGEAPAQ
387- 412 (27.32/16.82) LLRHQSAINTLLrSCIGPPGDG.AAGS.............
---------------------------------------------------------------------------
|