<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28094
| Description |
Zgc:114119 |
| Sequence | MAASLPQKAGMPPLLQQQQPHLPPGAAPAAGQQPMPPQGALREISPVFLCRIGQETVQDIVTRTMEIFQITRATQLPNGVTQSQAMYQDRFGKLQEHLRQLALLFRKLRLLYERCVEMTSDLQEEPSELLPYVGEELVNVKVEPCSSAVNQERKEVLEKVRQKNHEMKVLMDQMRNLLWDVNAMLTHRK |
| Length | 189 |
| Position | Head |
| Organism | Gasterosteus aculeatus (Three-spined stickleback) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Perciformes> Cottioidei> Gasterosteales> Gasterosteidae>
Gasterosteus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.444 |
| Instability index | 58.51 |
| Isoelectric point | 7.75 |
| Molecular weight | 21577.87 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28094
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.06| 15| 17| 47| 63| 2
---------------------------------------------------------------------------
47- 63 (20.51/21.49) VFlcRIGQET.VQDIVTR
67- 82 (21.55/13.79) IF..QITRATqLPNGVTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.20| 23| 25| 120| 142| 3
---------------------------------------------------------------------------
120- 142 (37.20/25.43) SDLQEEPSELLPYVGEELVNVKV
147- 169 (37.00/25.26) SAVNQERKEVLEKVRQKNHEMKV
---------------------------------------------------------------------------
|