| Description | Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MATESNGMHMTSSSSPPPAPDDEPRYGGYSRFEIELEFVQSLANPFYLNHLAAQKLLTQPAFVAYLAYLQYWNRPPYLKYLTYPGPTLRHLELLQQERFRQDIMSPDLVQRLVEEGMRSAVQWHREGA |
| Length | 128 |
| Position | Middle |
| Organism | Cordyceps militaris (strain CM01) (Caterpillar fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Cordycipitaceae> Cordyceps. |
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.540 |
| Instability index | 75.62 |
| Isoelectric point | 5.76 |
| Molecular weight | 14862.65 |
| Publications | PubMed=22112802 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP28078
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.81| 16| 22| 55| 70| 1
---------------------------------------------------------------------------
55- 70 (27.97/15.77) KLLTQPA.FVAYLAYLQ
79- 95 (24.84/13.41) KYLTYPGpTLRHLELLQ
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) PRYGGYSRFEI 2) YLKYLTY | 24 77 | 34 83 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab