| Description | Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MALGLDDDELKSVEQILSRLAQLSSSIQSLKLDIIKSNPLPHPDSLHASAQILQRNLQTVLDCLAENADLFSRVAVRPSTNYPGRAHEAVLTQLLRKKLEPDVEELVTRGRETARLATPAGVAGLQALWDELRAWTQSRIADYVRDEAGGAYTKAEREMGTEGVRTGLRRDIDDDDDDEDEDDDEEEEEEEEEEDKAVVVGAGLGGDEPPAPPRGPEIETLLWFSARADFDVPRNIDYERKGAAVMRGLDGINIPPQKMEGVDFPVENMGGVHPAVKPMRR |
| Length | 281 |
| Position | Head |
| Organism | Cordyceps militaris (strain CM01) (Caterpillar fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Cordycipitaceae> Cordyceps. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.622 |
| Instability index | 54.67 |
| Isoelectric point | 4.47 |
| Molecular weight | 31070.18 |
| Publications | PubMed=22112802 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP28076
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.00| 21| 93| 100| 148| 1
---------------------------------------------------------------------------
128- 148 (39.59/47.56) LWDELRA.WTQSRIADYVRDEA
222- 243 (35.41/ 6.55) LWFSARAdFDVPRNIDYERKGA
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) PEIETLLWFSARADFDVPRNIDYERK 2) VKPMRR | 216 276 | 241 281 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab