<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28063
Description |
Mediator of RNA polymerase II transcription subunit 12 |
Sequence | MQDYGMGPGRSGPYGVTVPPDLLHHANPGSISHLNYRQNSLGLYTQNQPLPAGGPRVDPYRPVRLPMQKLPTRPTYPGVLPTTMTTVMGLEPSSYKTSVYRQQQPTVPQGQRLRQQLQAKIQSQGMLGQSSVHQMTPSSSYGLQTSQGYTSYVSHVGLQQHTGPAGTMVPPSYSSQPYQSTHPSTNPTLVDPTRHLQQRPSGYVHQQAPTYGHGLTSTQRYPATTQYQHIWTLLSQLEELLVHWMWPSFSA |
Length | 251 |
Position | Kinase |
Organism | Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea>
Cricetidae> Cricetinae> Cricetulus.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.710 |
Instability index | 51.07 |
Isoelectric point | 9.73 |
Molecular weight | 27859.95 |
Publications | PubMed=21804562
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | beta-catenin binding GO:0008013 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28063
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.67| 13| 54| 44| 56| 1
---------------------------------------------------------------------------
44- 56 (26.44/10.48) YTQNQPLPAGGPR
100- 112 (26.23/10.34) YRQQQPTVPQGQR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 123.11| 26| 134| 57| 83| 2
---------------------------------------------------------------------------
57- 83 (47.33/21.04) VDPYRPvRLPMQKLPT......RPTYPGVLPTT
169- 189 (39.18/13.76) VPP....SYSSQ..PY......QSTHPSTNPTL
190- 218 (36.60/12.42) VDPTRH....LQQRPSgyvhqqAPTYGHGLTST
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.97| 26| 107| 115| 140| 3
---------------------------------------------------------------------------
115- 140 (47.30/24.20) QQLQAKIQSQ...GMLGQSS...VHQMTPSSS
219- 250 (41.67/20.58) QRYPATTQYQhiwTLLSQLEellVHWMWPSFS
---------------------------------------------------------------------------
|