<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28050
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFTALFGAQADPPPPPSALGFGPGKPPPPPPPPPGGGPGTAPPPTATSAPAGADKSAAGSGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLSGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
| Length | 244 |
| Position | Head |
| Organism | Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea>
Cricetidae> Cricetinae> Cricetulus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.041 |
| Instability index | 66.80 |
| Isoelectric point | 9.88 |
| Molecular weight | 26302.70 |
| Publications | PubMed=21804562
PubMed=29704459
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28050
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.51| 25| 115| 99| 130| 1
---------------------------------------------------------------------------
99- 130 (35.73/23.92) KKVKEKLSnflPDLPGMidlpGSHDNSSLRSL
219- 243 (45.78/17.46) KKKKNRHS...PDHPGM....GSSQASSSSSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.49| 21| 27| 16| 40| 2
---------------------------------------------------------------------------
16- 40 (42.90/22.01) PPPSAlgfgPGKPPPPPPPPPGGGP
44- 64 (39.59/12.88) PPPTA....TSAPAGADKSAAGSGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.21| 16| 17| 170| 185| 4
---------------------------------------------------------------------------
170- 185 (28.42/12.07) PPK...KKNKHKHKQSRTQ
189- 207 (21.78/ 7.88) PPEtpsDSDHKKKKKKKEE
---------------------------------------------------------------------------
|