<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28049
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRSTCYQYCDFLVKEGTVTMGPSAHGISVEAEYGPCVVASDCWSLLLEFLQSFLGSHTPGPPTVFGNSHDAVYGPADTMIQYMELFNKI |
Length | 138 |
Position | Head |
Organism | Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea>
Cricetidae> Cricetinae> Cricetulus.
|
Aromaticity | 0.13 |
Grand average of hydropathy | 0.127 |
Instability index | 32.15 |
Isoelectric point | 4.83 |
Molecular weight | 15260.34 |
Publications | PubMed=21804562
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP28049
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 114.77| 33| 37| 52| 84| 1
---------------------------------------------------------------------------
52- 84 (64.51/42.58) STCYQ.YCDFLVK.EGTVTMG.PSAHGISVEAEYGP
89- 124 (50.25/31.82) SDCWSlLLEFLQSfLGSHTPGpPTVFGNSHDAVYGP
---------------------------------------------------------------------------
|