<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28047
Description |
Mediator of RNA polymerase II transcription subunit 29 |
Sequence | MVVNPVQKEDPAYASFLAVSTGKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQITCAKDIHTALLDCANKVTGKTTAASAGPGGSI |
Length | 130 |
Position | Tail |
Organism | Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea>
Cricetidae> Cricetinae> Cricetulus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.083 |
Instability index | 53.03 |
Isoelectric point | 5.48 |
Molecular weight | 13797.61 |
Publications | PubMed=21804562
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28047
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 76.08| 16| 72| 4| 19| 1
---------------------------------------------------------------------------
4- 19 (27.82/15.05) NPVQKEDPAYASFLAV
28- 42 (21.10/10.11) .PIQRFDKCLEEFYAL
78- 93 (27.16/14.56) DAVQPDSLPYPQYLAV
---------------------------------------------------------------------------
|