<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28037
| Description |
Mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MGPIPVEQLIPYVDEDGSKNDDRAGPPRFATEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
| Length | 73 |
| Position | Head |
| Organism | Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea>
Cricetidae> Cricetinae> Cricetulus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.897 |
| Instability index | 45.92 |
| Isoelectric point | 6.22 |
| Molecular weight | 8519.69 |
| Publications | PubMed=21804562
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28037
No repeats found
No repeats found
|