<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28037
Description |
Mediator of RNA polymerase II transcription subunit 30 |
Sequence | MGPIPVEQLIPYVDEDGSKNDDRAGPPRFATEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
Length | 73 |
Position | Head |
Organism | Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea>
Cricetidae> Cricetinae> Cricetulus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.897 |
Instability index | 45.92 |
Isoelectric point | 6.22 |
Molecular weight | 8519.69 |
Publications | PubMed=21804562
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28037
No repeats found
No repeats found
|