<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28032

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMVSPSGRAGNWPGSPQVSGPSPAARLPGMSPANPSLHSPIPDASHSPRAGTSSQTMPTNMPPPRKLPQRSWAASIPTILTHSALNILLLPSPTPGLVPGLAGSYLCSPLERFLGSVIMRRHLQRIIQQETLQLINSNEPGVIMFKTDALKCRVALSPKTNQTLQLKVTPENAGQWKADELQVLEKFFETRVAGPPFKANTLIAFTKLLGAPTHILRDCVHIMKLELFPDQATQLKWNVQFCLTIPPSAPPIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNPPRQGT
Length334
PositionTail
OrganismCricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Cricetidae> Cricetinae> Cricetulus.
Aromaticity0.05
Grand average of hydropathy-0.117
Instability index60.40
Isoelectric point9.97
Molecular weight36202.87
Publications
PubMed=21804562

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28032
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.10|      21|      30|     128|     150|       1
---------------------------------------------------------------------------
  128-  150 (31.82/24.60)	QETLQL.INSNEPGviMFKTDALK
  160-  181 (33.28/19.56)	NQTLQLkVTPENAG..QWKADELQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.08|      17|      17|       7|      23|       2
---------------------------------------------------------------------------
    3-   20 (31.17/16.22)	SPSgR.AGNWPGSPQVSGP
   21-   39 (25.91/12.17)	SPAaRlPGMSPANPSLHSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.19|      19|      24|     265|     288|       3
---------------------------------------------------------------------------
  270-  288 (32.58/25.50)	QLTQKTSVPPQEPVSIIVP
  296-  314 (31.61/12.84)	GTTQQADIPRQQNSSVAAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      96.92|      27|     153|      76|     113|       5
---------------------------------------------------------------------------
   61-   74 ( 4.78/ 7.03)	.....PPPRKL.PqrSWAAS..........
   87-  113 (49.83/14.34)	LLLPSPTPGLV.P..GLAGSYLCSPLERFL
  242-  269 (42.30/10.61)	LTIPPSAPPIApP..GTPAVVLKSKMLFFL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28032 with Med14 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MVSPSGRAGNWPGSPQVSGPSPAARLPGMSPANPSLHSPIPDASHSPRAGTSSQTMPTNMPPPRKLPQRSWA
1
72










Molecular Recognition Features






MoRF SequenceStartStop




1) ILKRFAEM
320
327