<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28026
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MSEANAITGDELPTRWEIELEFVQSLANIQYLSYLAQNNYLNNPEFLNYLEYLNYWKSPGFAKHLVYPNCLHILTLLQNEEFRKNIVNPDFINTVMNDMVKRWRDSDVAEEKLEAPENSANGTENGAMEIDNVGTENDRTENGEALKNGS |
| Length | 150 |
| Position | Middle |
| Organism | Candida tenuis (strain ATCC 10573 / BCRC 21748 / CBS 615 / JCM 9827 / NBRC 10315 / NRRL Y-1498 / VKM Y-70) (Yeast) (Yamadazyma tenuis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Yamadazyma.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.655 |
| Instability index | 50.46 |
| Isoelectric point | 4.38 |
| Molecular weight | 17251.87 |
| Publications | PubMed=21788494
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28026
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.88| 17| 19| 53| 69| 3
---------------------------------------------------------------------------
53- 69 (33.07/22.78) LNYWKSPGFAKHLVYPN
74- 90 (28.82/19.04) LTLLQNEEFRKNIVNPD
---------------------------------------------------------------------------
|