<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28021
Description |
MED6-domain-containing protein |
Sequence | MSYGELDEIQWKNPEWINQFGLNTGNVLDYFSESPFYDRTSNNQVFKMQFQFQPPPPNLNTPLEYTKYFESKLSDMVGIEFVIAYIREPDFWIIRKQNRFSRDNVQILQSYYIIGANIYQSPKLYRLISSRLLNSTYSIKTAINLLNNLNEFKHDDDKADTSSNGNSTTQTPFTPAVTQPKKEINFDSILDDALNHSR |
Length | 198 |
Position | Head |
Organism | Candida tenuis (strain ATCC 10573 / BCRC 21748 / CBS 615 / JCM 9827 / NBRC 10315 / NRRL Y-1498 / VKM Y-70) (Yeast) (Yamadazyma tenuis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Yamadazyma.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.648 |
Instability index | 38.97 |
Isoelectric point | 5.22 |
Molecular weight | 23149.56 |
Publications | PubMed=21788494
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP28021
No repeats found
|