<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28020
| Description |
Uncharacterized protein (Fragment) |
| Sequence | LENIDTHVEQILQKFQDVFDVAVIQDKSKELLAVESLAMETDALSIIRFCEDLLGITRSLRESWCLDSIKVNPVQDKQVEQAEINRIFSKFNQLTDSISKYQK |
| Length | 103 |
| Position | Head |
| Organism | Candida tenuis (strain ATCC 10573 / BCRC 21748 / CBS 615 / JCM 9827 / NBRC 10315 / NRRL Y-1498 / VKM Y-70) (Yeast) (Yamadazyma tenuis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Yamadazyma.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.241 |
| Instability index | 45.82 |
| Isoelectric point | 4.69 |
| Molecular weight | 11902.42 |
| Publications | PubMed=21788494
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28020
No repeats found
No repeats found
|