<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28019
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSEDLISALYPPPPLFYKYFTSENLQKLKECQSDDKPIEGELKFLVPPSQPPGTHYRGYGNIWSFEDKLPKLSEMGYTQLYEDTDDQSAGSNKITELHKLMKSLLVNFIELIGIMHINPSEFHTKIEDLKVILINMNHILNSYRPHQSRESLIMLLKQRINEKKEEINSIDTKMSDIKDKLLTLINFSDVKLIQPDVKSDTLNTDQIKEKILYKLLKDI |
| Length | 219 |
| Position | Middle |
| Organism | Candida tenuis (strain ATCC 10573 / BCRC 21748 / CBS 615 / JCM 9827 / NBRC 10315 / NRRL Y-1498 / VKM Y-70) (Yeast) (Yamadazyma tenuis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Yamadazyma.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.494 |
| Instability index | 53.63 |
| Isoelectric point | 5.72 |
| Molecular weight | 25456.10 |
| Publications | PubMed=21788494
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28019
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.50| 20| 24| 112| 135| 1
---------------------------------------------------------------------------
116- 135 (34.70/26.18) HI.NPSEFHTKIEDLKVIL...IN
138- 161 (25.80/ 9.26) HIlNSYRPHQSRESLIMLLkqrIN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.49| 18| 27| 164| 182| 3
---------------------------------------------------------------------------
164- 182 (26.02/20.00) KEEINSiDTKMSD.IKDKLL
194- 212 (26.46/15.39) QPDVKS.DTLNTDqIKEKIL
---------------------------------------------------------------------------
|