<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28018
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MYEYNSRSEKNSILTDRMLPRKEQNNLSVPISRVGSSARLNQLNSPGNFNSFPSTPNAYQVSSLNPIRASSRSVPPKSIQDQQFEEKFNNLEIVQIVRDFEEQLANLSRKASSFEADGLEDTISSLVDINQQIIEQIDQLGKHKQLGETIQALEDEKVGLADRSRSILKSLIEFRSELNKLPSLPTNKTEPQDSLADMDIDEVLKYGMKLSKFTKVPPSASGMVYQIHPNNFIWPAEDSLRRGMLAMSSLKGDEIIQKELGIKGNDNVPTEEMEDIETAGNEDTFKKPAPKGANHNKSSDATIAAAAPTLNLDLFDPDDEDDSD |
| Length | 324 |
| Position | Middle |
| Organism | Candida tenuis (strain ATCC 10573 / BCRC 21748 / CBS 615 / JCM 9827 / NBRC 10315 / NRRL Y-1498 / VKM Y-70) (Yeast) (Yamadazyma tenuis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Yamadazyma.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.692 |
| Instability index | 54.60 |
| Isoelectric point | 4.73 |
| Molecular weight | 36085.77 |
| Publications | PubMed=21788494
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28018
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.79| 14| 52| 201| 217| 1
---------------------------------------------------------------------------
172- 185 (23.18/10.49) IEFRSELNKLPSLP
204- 217 (23.61/10.56) LKYGMKLSKFTKVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 88.79| 23| 53| 87| 109| 2
---------------------------------------------------------------------------
87- 109 (37.47/25.12) KFNNL.EIVQIVRDFEEQLANLSR
122- 140 (21.62/11.72) TISSL...VDINQQIIEQIDQL..
142- 165 (29.70/18.55) KHKQLgETIQALEDEKVGLADRSR
---------------------------------------------------------------------------
|