<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28013
Description |
Uncharacterized protein |
Sequence | MTDRLTQLQICVDQLIEQFNATVNYVNVHSEQAPLDEDPSSVTNIAASAPVAGQVPPQPTQPQTGQTSNGLSDHPTSHESEGSGANFDNTINELSTDIILKSRQISMLIDSLPGVGISEDSQMQLIKDLSVELQEVESERIQKIHQKDELLKWVEGLILEVASGISNTK |
Length | 169 |
Position | Middle |
Organism | Candida tenuis (strain ATCC 10573 / BCRC 21748 / CBS 615 / JCM 9827 / NBRC 10315 / NRRL Y-1498 / VKM Y-70) (Yeast) (Yamadazyma tenuis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Yamadazyma.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.387 |
Instability index | 41.10 |
Isoelectric point | 4.32 |
Molecular weight | 18402.21 |
Publications | PubMed=21788494
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28013
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.65| 28| 107| 3| 32| 1
---------------------------------------------------------------------------
3- 32 (44.64/33.36) DRLTQLQICVD...QLIEQFnaTVNYVNVHSEQ
110- 140 (41.01/24.56) DSLPGVGISEDsqmQLIKDL..SVELQEVESER
---------------------------------------------------------------------------
|