Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MTEKQINLAEGIESYYLIDSTHVYKQPKPTPIDNLLKLYGLEPIVKSLARTNPDGSKGVKLRKSYKNHIQDLPGKHQVAPAKPIPSGLLDPSAAQAPDIIKELDPELLSKAMKFEKTPINGIPGFNTADLAINDQQMLMRGDDMSENDEYGSKKSKRKKKIQNGSDPKRQHI |
Length | 172 |
Position | Head |
Organism | Spathaspora passalidarum (strain NRRL Y-27907 / 11-Y1) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Spathaspora. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.799 |
Instability index | 32.25 |
Isoelectric point | 9.22 |
Molecular weight | 19172.78 |
Publications | PubMed=21788494 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP28009 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 114.37| 34| 37| 52| 85| 1 --------------------------------------------------------------------------- 52- 85 (58.91/33.18) NPDGSKGVKLRKSYKNHIQDLPGKHQVAPAKPIP 90- 123 (55.46/30.87) DPSAAQAPDIIKELDPELLSKAMKFEKTPINGIP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KLYGLEPI 2) LRKSYKNHI 3) YYLID | 37 61 15 | 44 69 19 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab