<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27999
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLPYRKQDNQLKPIPRISSSQRLNQPPIQPNGTPPQQAPSTPSAYVSSSLNPIRNLPTTQGNIKSKIRTKEDLQKFEKLPIVAKVNEFETLLNGIADDISKFKDVEIQEKVKRIIEVNDILKSNIEDLNKHRDFSYQVDQLSNENKQLEERAKGILRELIFYRNELKSLPRLPKNEVTPASEVEVQEILKYAMKLAKFTKAPPAMANMPFQIHPNNYIWPAEDALRRGMLAMSSLQGDEIIKQELGGEEEEEEVKKETVDEVMKEETIPKQEQEEIIPRRGSFGYGTTTKKKEEQTDLNLDLFDPDDEYSD |
| Length | 311 |
| Position | Middle |
| Organism | Spathaspora passalidarum (strain NRRL Y-27907 / 11-Y1) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Spathaspora.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.857 |
| Instability index | 59.20 |
| Isoelectric point | 5.17 |
| Molecular weight | 35748.07 |
| Publications | PubMed=21788494
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27999
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.68| 22| 26| 67| 92| 1
---------------------------------------------------------------------------
71- 92 (35.63/26.22) EDLQKFEKLPI...VAKVNEFETLL
97- 121 (30.05/12.64) DDISKFKDVEIqekVKRIIEVNDIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.43| 17| 19| 238| 254| 2
---------------------------------------------------------------------------
238- 254 (28.11/15.38) DEIIKQELGGEEEEEEV
260- 276 (29.32/16.33) DEVMKEETIPKQEQEEI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.45| 19| 26| 13| 37| 3
---------------------------------------------------------------------------
13- 37 (23.59/25.61) PIPRISSSqrLNqpPIQpnGTPPQQ
42- 60 (35.86/16.45) PSAYVSSS..LN..PIR..NLPTTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.43| 17| 26| 157| 173| 4
---------------------------------------------------------------------------
157- 173 (28.71/16.63) RELIFYRNELKSLPRLP
186- 202 (27.72/15.86) QEILKYAMKLAKFTKAP
---------------------------------------------------------------------------
|