Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MLPYRKQDNQLKPIPRISSSQRLNQPPIQPNGTPPQQAPSTPSAYVSSSLNPIRNLPTTQGNIKSKIRTKEDLQKFEKLPIVAKVNEFETLLNGIADDISKFKDVEIQEKVKRIIEVNDILKSNIEDLNKHRDFSYQVDQLSNENKQLEERAKGILRELIFYRNELKSLPRLPKNEVTPASEVEVQEILKYAMKLAKFTKAPPAMANMPFQIHPNNYIWPAEDALRRGMLAMSSLQGDEIIKQELGGEEEEEEVKKETVDEVMKEETIPKQEQEEIIPRRGSFGYGTTTKKKEEQTDLNLDLFDPDDEYSD |
Length | 311 |
Position | Middle |
Organism | Spathaspora passalidarum (strain NRRL Y-27907 / 11-Y1) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Spathaspora. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.857 |
Instability index | 59.20 |
Isoelectric point | 5.17 |
Molecular weight | 35748.07 |
Publications | PubMed=21788494 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP27999 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 65.68| 22| 26| 67| 92| 1 --------------------------------------------------------------------------- 71- 92 (35.63/26.22) EDLQKFEKLPI...VAKVNEFETLL 97- 121 (30.05/12.64) DDISKFKDVEIqekVKRIIEVNDIL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 57.43| 17| 19| 238| 254| 2 --------------------------------------------------------------------------- 238- 254 (28.11/15.38) DEIIKQELGGEEEEEEV 260- 276 (29.32/16.33) DEVMKEETIPKQEQEEI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 59.45| 19| 26| 13| 37| 3 --------------------------------------------------------------------------- 13- 37 (23.59/25.61) PIPRISSSqrLNqpPIQpnGTPPQQ 42- 60 (35.86/16.45) PSAYVSSS..LN..PIR..NLPTTQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 56.43| 17| 26| 157| 173| 4 --------------------------------------------------------------------------- 157- 173 (28.71/16.63) RELIFYRNELKSLPRLP 186- 202 (27.72/15.86) QEILKYAMKLAKFTKAP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EQEEIIPRRGSFGYGTTTKKKEEQTDLNLDLFDPDDEYSD 2) MLPYRKQDNQLKPIPRI | 272 1 | 311 17 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab