<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27996
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MVTAVLLVQKATPETITQFHDQLSNELPTSKGKWNFNFKIFRNNPYSIPPDLVETTTTSPESKFLFTLSPSYLPDSTITLVNGKSAGVFTNLIEEEASELSHPTELTIPNEHLHRGATTGLNDRFDIFVGQKLQSLWTQRQIIKGDGGQIYELENGNLCIKTSNVFLHGNFRGLLIQIDLNDHLCDTKNPDSFKQVFDKVSEKYGIPPGNLCCEVLDTKYLDKYGDLCFQYSKILNF |
Length | 237 |
Position | Head |
Organism | Spathaspora passalidarum (strain NRRL Y-27907 / 11-Y1) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Spathaspora.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.337 |
Instability index | 18.07 |
Isoelectric point | 5.36 |
Molecular weight | 26755.96 |
Publications | PubMed=21788494
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP27996
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 94.48| 27| 155| 23| 50| 1
---------------------------------------------------------------------------
23- 50 (48.19/36.12) LSNELPTSKGKWNFNfKIFR..NNPYSIPP
180- 208 (46.29/29.39) LNDHLCDTKNPDSFK.QVFDkvSEKYGIPP
---------------------------------------------------------------------------
|